PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_9684426g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 135aa    MW: 14927.9 Da    PI: 10.7662
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_9684426g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.2e-182469147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v++lG+++W++I++ ++ gR++k+c++rw + 
  MA_9684426g0010 24 KGPWSPEEDASLQKLVEKLGPRNWSLISKGIP-GRSGKSCRLRWCNQ 69
                     79******************************.***********985 PP

2Myb_DNA-binding55.71.1e-1778120347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEd  + +a+ ++G++ W+tIar ++ gRt++ +k++w++ 
  MA_9684426g0010  78 PFSPEEDRMIMEAHSMHGNK-WATIARILP-GRTDNAIKNHWNST 120
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3291970IPR017930Myb domain
SuperFamilySSF466891.08E-3222117IPR009057Homeodomain-like
SMARTSM007171.3E-152372IPR001005SANT/Myb domain
PfamPF002491.6E-182469IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-262577IPR009057Homeodomain-like
CDDcd001671.12E-142668No hitNo description
PROSITE profilePS5129426.09271125IPR017930Myb domain
SMARTSM007171.1E-1475123IPR001005SANT/Myb domain
PfamPF002492.0E-1578120IPR001005SANT/Myb domain
CDDcd001674.87E-1278121No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2478124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MAVGNTKAPG SESSGSGERG QRIKGPWSPE EDASLQKLVE KLGPRNWSLI SKGIPGRSGK  60
SCRLRWCNQL SPQVQHRPFS PEEDRMIMEA HSMHGNKWAT IARILPGRTD NAIKNHWNST  120
LRRKCLAEKD NSGGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-42231253105MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-412312557159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-412312557159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-42231253105C-Myb DNA-Binding Domain
1msf_C2e-42231253105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002272706.13e-62PREDICTED: myb-related protein B
RefseqXP_002975777.15e-63hypothetical protein SELMODRAFT_103999, partial
RefseqXP_008462845.17e-62PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-58MYB44_ARATH; Transcription factor MYB44
TrEMBLB8LM226e-65B8LM22_PICSI; Putative uncharacterized protein
TrEMBLI6LFW22e-65I6LFW2_PICGL; R2R3-MYB transcription factor MYB9 (Fragment)
STRINGVIT_13s0067g01360.t011e-61(Vitis vinifera)
STRINGEFJ234061e-62(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-59myb domain protein 73